IGEM team meeting nodes 9/8/14
Jump to navigation
Jump to search
* Call-in info: \url{https://zoom.us/j/820128495} Or, go to \url{https://zoom.us/join} and enter meeting ID: 820 128 495
*
Attendees: Patrik, Lou, Jen, Moises, Rachel, Marc, Advait (zoom), Maria (zoom), Rebecca, Johan (zoom)
#
##Intro/Go-Around (5 min):
*
##iGEM update (5 min):
People attending jamboree: Advait, Patrik, Rebecca, Eri - anyone else?
October 10: BioBrick Part DNA due underlineatunderline the Registry; Project and part documentation due, Project and part documentation due, including documentation for all medal criteria
October 17: wiki(and parts registry) freeze! Judging form due!
##IndieGogo update (10 min)
Perk fulfilment spreadsheet: \url{https://docs.google.com/spreadsheets/d/1Z\_WsfOUZx5F2SYZ\_DIG2jHawgtBtqLOZgcDvcYv7-cw/edit?usp=sharing}
Who wants to take charge of fulfilling which perks?
* 3D printed: Patrik
* T-shirts (do we need them for the people going to iGEM?) 1) Need sizes and final #s (IndieGogo + extras) 2) At least three bids for shirt printing.
* Moises will set up google form for sizing etc.
* lab coats (need to be printed/embroidered with 'Biohacker' or 'Real Vegan Cheese' and have some custom text (as per our indiegogo page) If printed, same company as printing T-shirts.
* stickers - juul will take on printing, will organize packing and shipping party
* science textbook - juul will take on printing and shipping, will need help with notes and signatures. Rachel can help with notes.
* scheduling Vegan Cheese Tasting, Pick Our Brains, Biohacker Weekend
* More ask-a-biohacker videos needed?
* should we order more cards (We ran out of them) to give out at the Jamboree and any other things that come up. YES! probably psprint (Craig or Jared might have ordered the rvc cards before) * "Campaign has ended"-update needs to be sent out
##Bylaws and bureaucracy update
Need to arrange founding meeting, and maybe down-select board members (if you would like to become one add you name to the wiki)
* \url{https://wiki.realvegancheese.org/index.php/Bureaucracy}
* Maria is added
Treasurer: Marc?
CEO/President/Chair: We nominate Craig
Vice President (can be, and we can have more than one):
Secretary: Advait? Maria, depending on age requirements?
\url{http://www.nonprofitlawblog.com/duties-of-the-secretary-of-a-nonprofit-corporation/}
-\url{https://wiki.realvegancheese.org/index.php/Bureaucracy}
##Experiment planning
* 3-day grand cloning experiment
* yeast experiments - Zymo research kit
* Why salmon sperm? \url{http://www.madsci.org/posts/archives/2012-04/1334787478.Cb.r.html}
* Rachel found supplier for DNA from 30 plant species, for $230 for testing purposes. \url{http://zyagen.com/index.php?main\_page=index\&cPath=6\_460\&zenid=4c0b67bcc9189f98438f04e9f460ad07} But I'm looking into other sources. We can just do plant genomic DNA extractions.
* Marc will go pick up $400 shaker from CL in Emeryville and ensure that it fits in the backroom lab incubator (and that it has CO2 venting, and sterilizing it)
* We need dimensions of incubator in Ahnon's back room to see if we can fit our orbital shaker in it.
* Potential orbital shaker (CL) dimensions: 13.5" x 17.4"
Experiment planning for E coli.:
Day 1: Pour Kan+ LB plates? Order two sleeves (20 plates) LB Amp from Carolina? Resuspend DNA \& clone all gBlocks into pD1214 plasmid using Electra cloning kit (~30 min), transform plasmid into chemically competent dH5alpha E. coli 5 minutes using Zymo kit, outgrowth step = (40 minutes.) The competent cells we are using will be
*Mix \& Go* Competent Cells - Strain Zymo 5α \url{http://www.zymoresearch.com/e-coli/chemically-competent-cells/strain-zymo5alpha}
Protocol is at \url{http://www.zymoresearch.com/downloads/dl/file/id/173/t3015i.pdf}
Day 2: Pick colonies--> can grow O/N and do midi-prep on OR grow >= 4 hrs (per Johan's last experiment) and midi prep later Day 2 (~1 hr - 2 hr to midi prep plasmids)
OR Day 3: Midi-prep plasmids (1 - 2 hr), quantify \& aliquot for sequencing (30min-1hr.)
Experiment planning for yeast: Link to protocol for yeat transformation kit: \url{http://www.clontech.com/US/Products/Protein\_Interactions\_and\_Profiling/Yeast\_Transformation\_Kit/ibcGetAttachment.jsp?cItemId=80961\&fileId=6856812\&sitex=10020:22372:US}
##Documentation / livestreaming equipment
This was our last IGG stretch goal, for $5K
Marc has been investigating. Want to have a camera at each event.
Equipment to be divided between CCL \& BioC (BioC need mics; CCL needs projector)
##Redesigning human alpha-S1
Patrik can run through this again tonight, if there is interest
>gi|1345671|sp|P47710.1|CASA1\_HUMAN RecName: Full=Alpha-S1-casein; Contains: RecName: Full=Casoxin-D; Flags: Precursor
**MRLLILTCLVAVALA**RPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNE
STQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLN
QLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW
We could also just order this as a gene, with the exact same sequence as we ordered before: \url{http://www.idtdna.com/pages/products/genes/custom-gene-synthesis}
$225 for up to 500bp; $0.45/bp up to 1000bp (but takes much longer to ship: 8-12 days, vs 2-4 days for gblocks)
##Need ELSI working group meeting soon
Rebecca will organize (possibly before next Monday's meeting, at 6pm?)
-contact Christina Agapakis about edible lab products; Patrick Bauer PhD candidate at Berkeley on food safety
Kim de Mora from iGEM suggested we get in touch with Christina Agapakis, who did the "Philospher's Toe" cheese, and is on the iGEM Design committee. She should have useful insights into cheese making, but also dealing with tasting your own experiments, and bringing products from the lab to the table. Also Ken Oye, who is head of human practices. Kim also mentioned an iGEM SynBio Beer project, where they filter sterilized the beer (and presumably drank it?)
##Final Biohacker questions
* Do you think you will be able to (eventually) sell this cheaper than cowcheese? --Anonymous
* How is your process different than Monsanto's? In other words, will I actually be eating genetically modified food? -- Megan Crocker
* CO2 efficiency
* How will you get the casein out of the yeast? Will you be able to get the yeast to export the casein? (Patrik answered in email)